PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID mrna18691.1-v1.0-hybrid
Common Namemyb
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Rosoideae; Potentilleae; Fragariinae; Fragaria
Family MYB
Protein Properties Length: 284aa    MW: 32319.4 Da    PI: 9.5342
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
mrna18691.1-v1.0-hybridgenomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding50.54.9e-161461148
                             TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
          Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                             rg+WT+ Ed ll ++++ +G g+W++ +++ g+ R++k+c++rw +yl
  mrna18691.1-v1.0-hybrid 14 RGPWTPREDTLLTKYIEAHGEGHWRSLPKKAGLLRCGKSCRLRWMNYL 61
                             89******************************99************97 PP

2Myb_DNA-binding53.55.3e-1767112148
                              TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
          Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                              rg+ T++Ed+l+++++ +lG++ W++Ia +++ gRt++++k++w+++l
  mrna18691.1-v1.0-hybrid  67 RGNITPDEDDLIIRLHSLLGNR-WSLIAGRLP-GRTDNEIKNYWNTHL 112
                              7999******************.*********.************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129414.704961IPR017930Myb domain
SuperFamilySSF466893.08E-3011108IPR009057Homeodomain-like
SMARTSM007171.1E-121363IPR001005SANT/Myb domain
PfamPF002493.4E-141461IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.607.7E-241568IPR009057Homeodomain-like
CDDcd001675.37E-101661No hitNo description
PROSITE profilePS5129426.81762116IPR017930Myb domain
SMARTSM007172.1E-1666114IPR001005SANT/Myb domain
PfamPF002491.8E-1567112IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.2E-2669116IPR009057Homeodomain-like
CDDcd001673.71E-1271112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0009005anatomyroot
PO:0007134developmental stagesporophyte vegetative stage
Sequence ? help Back to Top
Protein Sequence    Length: 284 aa     Download sequence    Send to blast
MGRAPCCSKV GLHRGPWTPR EDTLLTKYIE AHGEGHWRSL PKKAGLLRCG KSCRLRWMNY  60
LRPDIKRGNI TPDEDDLIIR LHSLLGNRWS LIAGRLPGRT DNEIKNYWNT HLSKRLMNEG  120
TDPNTHQKLS QPPPPKENKR KKKQNHKSKH KNKTEKRSLP EKPKVHLPKP TRITSFVNLP  180
RQDSFTTAST NVSSSQDQVQ DHINNIIPWS DIKEGGAVFS VGDGSTSSDF ECDQSRIIPN  240
VAAGGDDHSL ENIYEEYLQA LLKTTDQDQN YQVELDTFAE SLLI
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A1e-24121165108B-MYB
1h8a_C2e-241211625128MYB TRANSFORMING PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLN6815460.0LN681546.1 Fragaria vesca mRNA for transcription factor MYB 12 (myb gene).
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001295449.10.0transcriptional activator Myb
TrEMBLA0A0A8WJ380.0A0A0A8WJ38_FRAVE; Transcription factor MYB 12
STRINGVIT_15s0046g00170.t011e-113(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF3134817
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G22640.14e-69myb domain protein 3